PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_12041_iso_4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 575aa    MW: 63925.6 Da    PI: 8.3566
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_12041_iso_4genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.72e-1658104148
                                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                           +g WT+eEd+ l++av+ + g++Wk+Ia+ ++  R++ qc +rwqk+l
  cra_locus_12041_iso_4_len_2222_ver_3  58 KGGWTPEEDDTLKRAVAAFKGKCWKKIAEFFP-DRSEVQCLHRWQKVL 104
                                           688*****************************.************986 PP

2Myb_DNA-binding63.93.1e-20110156148
                                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                           +g+WT+eEde++v++v+++G+  W+ Ia+ ++ gR +kqc++rw+++l
  cra_locus_12041_iso_4_len_2222_ver_3 110 KGPWTQEEDEKIVQLVAKYGPTKWSVIAKSLP-GRIGKQCRERWHNHL 156
                                           79******************************.*************97 PP

3Myb_DNA-binding53.65e-17162205146
                                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
                       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                           +++WT eE++ l +a++ +G++ W+ Ia+ ++ gRt++ +k++w++
  cra_locus_12041_iso_4_len_2222_ver_3 162 KDAWTLEEELALMNAHRVHGNK-WAEIAKVLP-GRTDNAIKNHWNS 205
                                           679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.57153104IPR017930Myb domain
SuperFamilySSF466892.37E-1455111IPR009057Homeodomain-like
SMARTSM007174.2E-1557106IPR001005SANT/Myb domain
PfamPF002492.8E-1558104IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.6E-1960109IPR009057Homeodomain-like
CDDcd001674.33E-1361104No hitNo description
PROSITE profilePS5129432.741105160IPR017930Myb domain
SuperFamilySSF466895.99E-32107203IPR009057Homeodomain-like
SMARTSM007178.5E-19109158IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.2E-28110159IPR009057Homeodomain-like
PfamPF002494.1E-19110156IPR001005SANT/Myb domain
CDDcd001671.28E-16112156No hitNo description
Gene3DG3DSA:1.10.10.603.2E-23160211IPR009057Homeodomain-like
PROSITE profilePS5129422.503161211IPR017930Myb domain
SMARTSM007177.0E-16161209IPR001005SANT/Myb domain
PfamPF002493.5E-15162205IPR001005SANT/Myb domain
CDDcd001674.62E-12164207No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 575 aa     Download sequence    Send to blast
MAEVKDECCL ENKQSAAGST SSVSENSESV TIKSPGIGSP TPTSPSHRRT TGPIRRAKGG  60
WTPEEDDTLK RAVAAFKGKC WKKIAEFFPD RSEVQCLHRW QKVLNPELVK GPWTQEEDEK  120
IVQLVAKYGP TKWSVIAKSL PGRIGKQCRE RWHNHLNPNI KKDAWTLEEE LALMNAHRVH  180
GNKWAEIAKV LPGRTDNAIK NHWNSSLKKK LDFYLATGNL PPVAKNGLQN GSKDLSTTAS  240
TGNLIDSFTR GSDLTATSPG IGDGCKLEVV GKDNTEIAIL SQCVGVSTSC PQQESADYED  300
IRYEELSSQV NSIEIDPESA VKLDQCRTHS ENVKYEVPQG SLHSPVPEYG PLYYEPPQLE  360
SFVPLYPDVQ SICWVQYDSN SSLTLSPVAF FTPPRVRADE LFTQTPESIL KIAAKSFPHT  420
PSILRKRKTE TQSSTSSNKV EKVGNRSSSF QRSCHESPCD DKLNDSKTFN ASPPYRLRSK  480
RTTIFKSVEK QLEFSFNREQ SKNISKPGSS TIMDISPNKN NLXDIKDGRD IDCNGMKVGE  540
FSKLATVFRV ADKDKMQAAG LSKAFHNSTA EHHGY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C7e-70572115159MYB PROTO-ONCOGENE PROTEIN
1h89_C7e-70572115159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00482DAPTransfer from AT5G02320Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002270472.10.0PREDICTED: uncharacterized protein LOC100256181
RefseqXP_010654284.10.0PREDICTED: uncharacterized protein LOC100256181
TrEMBLA0A068UEC50.0A0A068UEC5_COFCA; Uncharacterized protein
STRINGVIT_08s0007g00360.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA54612437